DPCstruct | MC2774
Metacluster Properties and Pfam Annotations
| Number of structural domains | 18 |
|---|---|
| Mean domain length (aa) | 175 ± 12 aa |
| Standard deviation of domain lengths | 11.99 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 88.42 |
| Mean fraction of residues predicted as intrinsically disordered | 0.38 |
| Mean length-normalized TM-Score | 0.79 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 34.64 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0286 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7W1MK76 | 266-431 | VTCQLGDATLSLRPALEFWPLVGDVASQERAGTRCVDASTARLELSVDGPGPDQIAVAGRWAHLHAVGDGVRAVGIRRRIFQPSPGL… |
| A0A7Y2BE79 | 15-188 | RFGPEGADLLVRQALEPWPLMAEIADGGTTSRVVDNSTDRIEISISNPAALGENRVVVNGLLVAMREVDGTLVAGVRYKSASGWPAF… |
| A0A7V2G4K5 | 515-669 | None |
| A0A090WKC8 | 1-200 | None |
| A0A7W0ZSQ6 | 164-334 | None |
| A0A7W0Y3N6 | 70-237 | None |
| A0A1H5DLU1 | 619-780 | None |
| A0A0S8BSD7 | 583-752 | None |
| A0A7V9L3H8 | 389-553 | None |
| S4XJX2 | 953-1125 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.