DPCstruct | MC27737
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 247 ± 23 aa |
| Standard deviation of domain lengths | 23.40 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 74.88 |
| Mean fraction of residues predicted as intrinsically disordered | 0.37 |
| Mean length-normalized TM-Score | 0.55 |
| Mean intra-cluster local Distance Difference Test score | 0.62 |
| Mean intra-cluster sequence similarity (%) | 25.94 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5N6ZKW3 | 2-223 | TESSNIIKPKLQPQEKRDQRKREKQAALIEASLRSGKYALFLQEVPKIKTSHCRAWDCMPRRSTGNPIIRSYYRFALKRISARSIEY… |
| A6QSM2 | 1-262 | MVEKAVRPKRQRSESPASAIRATDSEYWKRRLAEHNAEQERRSLMTPKEIAAENGLQLRRELAAQPELTFILQPTPPGHMARAQCRA… |
| A0A370TTD8 | 71-339 | None |
| A0A1L7WHW1 | 33-298 | None |
| A0A093XUI6 | 70-343 | None |
| A0A094IV15 | 284-564 | None |
| J3NX70 | 155-422 | None |
| A0A094AYV5 | 1-205 | None |
| A0A3F3PJF4 | 10-245 | None |
| A0A397GH49 | 125-347 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.