DPCstruct | MC27733
Metacluster Properties and Pfam Annotations
| Number of structural domains | 42 |
|---|---|
| Mean domain length (aa) | 89 ± 16 aa |
| Standard deviation of domain lengths | 15.87 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 87.26 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.77 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 28.97 |
| Pfam Score | 93.33 |
| Assigned Pfam label(s) | PF08869- CL0236- CL0025 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A139X8D6 | 4-85 | DIFSIHANTPDVNPHVQTITVFDFLHDHYQLLRMGWTDSHKRIFNPILHLDIIEGKVWIQENRTDIDIGEELSSRGIPKSDI |
| A0A6P0XDY5 | 2-75 | TDNYLLLDTGWDKTGRVHAVVLHLRIVGEKIWIESDGTERGIALELLEQNISKEDIVLGFIRPKSRHLTDFSVA |
| A0A433V5G3 | 5-92 | None |
| A0A0S6VXK4 | 48-147 | None |
| A0A6L9IZ30 | 37-122 | None |
| A0A563VMK2 | 1-128 | None |
| A0A563VMQ5 | 1-76 | None |
| A0A563W4Q0 | 6-94 | None |
| A0A1Z4UYW7 | 1-60 | None |
| I4G047 | 299-397 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.