DPCstruct | MC2773
Metacluster Properties and Pfam Annotations
| Number of structural domains | 26 |
|---|---|
| Mean domain length (aa) | 108 ± 12 aa |
| Standard deviation of domain lengths | 11.57 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 79.65 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.79 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 29.33 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7X9P738 | 6-105 | WASDLVFESPAALREIYPALVRHAITSFSSGDVMRFLGAKVHGNFKGEVLSEFGRRPEGVRVKHWAGSNSMKLYDKFAVVLRPEVTI… |
| A0A450VCL4 | 1-111 | MQVEYATDVIFRRQSTFQPLFENIVRTAVHAIKAEHVATFLGRKLTAAYKDEVGNDFSTRIQGTRIRHHMGASSIKLYDKAGLIARV… |
| A0A7Y5SGM3 | 73-178 | None |
| A0A7V0UIU3 | 27-129 | None |
| A0A5M3WNB5 | 1-103 | None |
| A0A2G6PDE6 | 27-161 | None |
| A0A498QK12 | 135-230 | None |
| A0A2V9I473 | 244-361 | None |
| A0A6N7W7K4 | 74-185 | None |
| A0A3N5M9J9 | 244-357 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.