DPCstruct | MC27725
Metacluster Properties and Pfam Annotations
| Number of structural domains | 50 |
|---|---|
| Mean domain length (aa) | 112 ± 25 aa |
| Standard deviation of domain lengths | 24.75 |
| Length coefficient of variation | 0.22 |
| Mean AlphaFold2 pLDDT confidence score | 76.46 |
| Mean fraction of residues predicted as intrinsically disordered | 0.37 |
| Mean length-normalized TM-Score | 0.66 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 28.38 |
| Pfam Score | 97.73 |
| Assigned Pfam label(s) | PF00696- PF09269 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0P0XA81 | 34-115 | NEFEIFHDKGTNTWNVVGAGIERFVQMTNWQYSESLKRFQHALEACGVNKTLIKRGVKEGDTVVVGEMEMVWTDEPSKTRSS |
| A0A7K1BMZ3 | 18-112 | EEVRGARSVEPELDGFVVHRPIPEGIRIEREDDGSYRVVGRAAERAVALSDLTNLEALDFAHSRLKKIGVDKALARAGATEGDTVRI… |
| A0A2G6EZA6 | 5-76 | None |
| X8A587 | 21-120 | None |
| A0A2H6K9W1 | 685-803 | None |
| A0A6G3V1B5 | 1-80 | None |
| A0A7S2XZJ3 | 36-128 | None |
| A0A061D5S3 | 441-559 | None |
| A0A3S3Q0V8 | 465-607 | None |
| Q4N915 | 261-382 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.