DPCstruct | MC27723
Metacluster Properties and Pfam Annotations
| Number of structural domains | 7 |
|---|---|
| Mean domain length (aa) | 95 ± 6 aa |
| Standard deviation of domain lengths | 5.74 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 91.45 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.86 |
| Mean intra-cluster local Distance Difference Test score | 0.84 |
| Mean intra-cluster sequence similarity (%) | 32.82 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2N9JEB2 | 66-165 | RGRQLQDLGQSMNERRAFVLRMPSQRVVIELRTSSHRDAGHQWTTNDLHDIAAMSLALPYCDVTLADAATRSQALRTGLHRLFEVAL… |
| A0A7K1B4B5 | 1-85 | MTRAVFDAMPSFDVAVSLKASYHSDGNHRWTTNDIHDIDALGSTVPYCDIVVTDKAVASHLRRTGVAERLGTIVLSSLSDLAATL |
| A0A645ICK3 | 1-103 | None |
| A0A837E364 | 134-230 | None |
| A0A3S6Z1D8 | 34-122 | None |
| A0A0S9DS44 | 85-180 | None |
| A0A1E7Y3X3 | 42-137 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.