DPCstruct | MC2772
Metacluster Properties and Pfam Annotations
| Number of structural domains | 37 |
|---|---|
| Mean domain length (aa) | 184 ± 14 aa |
| Standard deviation of domain lengths | 13.98 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 86.60 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.68 |
| Mean intra-cluster local Distance Difference Test score | 0.59 |
| Mean intra-cluster sequence similarity (%) | 19.43 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1H0B4V5 | 2-175 | TVPLRFRQVNDYAWAHRFLSGFPNFHEANYGQGVVRGTFLLGGDVAEWRDIRAADLGNPPPDDVGARFRATNDWAARNGYVSGFPNF… |
| A0A7X9J068 | 816-1010 | GDLTPLHSECTSGNAVSTGCNSAVNRWCEGRDCTTTGFGPVEASGDDVTVACLVAPPRITVGYTTLSTFDGRCGTGSGQERAGWYCN… |
| A0A2E0TRX1 | 671-850 | None |
| A0A538QC08 | 64-246 | None |
| A0A7S2XPN4 | 452-657 | None |
| A0A7Y4MS72 | 70-283 | None |
| A0A6P0PUY1 | 244-426 | None |
| A0A2T5KV39 | 393-586 | None |
| A0A1G6TFZ5 | 543-719 | None |
| A0A6A5W1L7 | 108-306 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.