DPCstruct | MC27716
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 86 ± 4 aa |
| Standard deviation of domain lengths | 3.83 |
| Length coefficient of variation | 0.04 |
| Mean AlphaFold2 pLDDT confidence score | 81.88 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.89 |
| Mean intra-cluster local Distance Difference Test score | 0.83 |
| Mean intra-cluster sequence similarity (%) | 32.53 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| B8IET3 | 1-79 | MATIADLLTTRLLTDEQVDAAVMGYLADPAPGSRQIAHGLALDINAAVAAYRQAADLMQRKDVTVARRRVAVRTAILLA |
| A0A512JCZ4 | 11-94 | SGPTVLELLDRELLQPEIITRLAENYLAAPWLHTYTLGFGLVVDVAAAIEAYPLARPILASSLVSPRVKRSTLRTAILLARPQK |
| B8IDK5 | 4-89 | None |
| A0A2U8W0L2 | 1-87 | None |
| A0A2T5WU90 | 1-83 | None |
| A0A839P6A0 | 4-88 | None |
| B8IX91 | 24-108 | None |
| B8IC16 | 2-97 | None |
| A0A2U8VVF5 | 91-178 | None |
| B0UJG0 | 14-100 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.