DPCstruct | MC2771
Metacluster Properties and Pfam Annotations
| Number of structural domains | 240 |
|---|---|
| Mean domain length (aa) | 109 ± 25 aa |
| Standard deviation of domain lengths | 24.95 |
| Length coefficient of variation | 0.23 |
| Mean AlphaFold2 pLDDT confidence score | 81.53 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.44 |
| Mean intra-cluster local Distance Difference Test score | 0.68 |
| Mean intra-cluster sequence similarity (%) | 31.47 |
| Pfam Score | 95.98 |
| Assigned Pfam label(s) | CL0005- PF04885- CL0576- CL0001 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7X9IXN8 | 21-123 | GCTLEVHEVAPPPDAGAPDGGCFDGGLWCDGACIDPAISPDHCGACGVACGTHGDCVDGVCVCDPDYAWCPGGCTRLDSDRANCGAC… |
| A0A3M1CGK7 | 66-151 | VCQPCPQGLVECNGACVDLVNDPENCGSCGNTCPQGATCNSGVCECPAGQVNCNDVCADLSSDPQNCGACGNTCPSNGSCVSGTCQ |
| A0A521U8N4 | 59-177 | None |
| A0A521U7J5 | 91-197 | None |
| A0A521U618 | 340-414 | None |
| A0A521U4R9 | 315-417 | None |
| A0A2I0CVJ9 | 7-104 | None |
| A0A521TZZ9 | 365-481 | None |
| A0A521TYZ2 | 86-204 | None |
| A0A521TXD7 | 35-143 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.