DPCstruct | MC27707
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 64 ± 6 aa |
| Standard deviation of domain lengths | 6.40 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 87.08 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.91 |
| Mean intra-cluster local Distance Difference Test score | 0.90 |
| Mean intra-cluster sequence similarity (%) | 72.56 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0410 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1W0W408 | 1-71 | MSSNMQRQAVPLSRSEKCIVGTGLERQTALDSEVSVIAEREGKIISSDSHKILLSSSGKTISIPLVAHRHS |
| A0A816JKZ5 | 252-307 | SSNMQRQAVPLSRSEKCIVGTGLERQEALDSGVPAIAKHEGKILYTDTEKIILWEM |
| A0A059B5Z3 | 15-84 | None |
| A0A3P6D5Z1 | 5-62 | None |
| A0A6B9VA91 | 254-310 | None |
| A0A4S8I2F4 | 359-431 | None |
| A0A5N6PV42 | 97-155 | None |
| A0A6J5VLD4 | 72-128 | None |
| A0A251SVS4 | 177-233 | None |
| A0A7J8LSM5 | 1-68 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.