DPCstruct | MC27704
Metacluster Properties and Pfam Annotations
| Number of structural domains | 34 |
|---|---|
| Mean domain length (aa) | 200 ± 29 aa |
| Standard deviation of domain lengths | 29.45 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 83.61 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.70 |
| Mean intra-cluster local Distance Difference Test score | 0.61 |
| Mean intra-cluster sequence similarity (%) | 24.47 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF19281 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A143ZQ94 | 9-181 | ATLPPPAYGKTWELKEVFTIMHVREAVRTIDDKKISARLVYDESRLNTARLPVVWSSANHWHRGSMYGTVGFHFKWEELIAGKNFYW… |
| R7VA74 | 10-224 | LESLYEQAEGFVDEKHLQWKEVWTPIDYFYRDTSKELKLAAERDQRMEMYLKDNSGDPRCPINGRLEGLHFATNINYCTGQPFEKTP… |
| Q86L26 | 8-173 | None |
| A0A7E4WA73 | 164-371 | None |
| A0A2P4VRX1 | 159-384 | None |
| A0A1V1X1A2 | 16-171 | None |
| A0A0R3QRA4 | 88-308 | None |
| R7UNU0 | 26-232 | None |
| A0A0N4W9G3 | 23-207 | None |
| G5ECJ7 | 69-279 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.