DPCstruct | MC27701
Metacluster Properties and Pfam Annotations
| Number of structural domains | 29 |
|---|---|
| Mean domain length (aa) | 112 ± 12 aa |
| Standard deviation of domain lengths | 11.94 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 81.21 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.56 |
| Mean intra-cluster local Distance Difference Test score | 0.69 |
| Mean intra-cluster sequence similarity (%) | 28.79 |
| Pfam Score | 65.38 |
| Assigned Pfam label(s) | CL0229- CL0125 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6P8T5S6 | 225-349 | WKGGVMKHPVQQDGNSCGVVVCMMAKKVMEVFPKTPKMTFGTTTREMAHQRKVLALEILTASVFDKEVNCAMCAAIKPPGSVTHQTH… |
| R7URZ7 | 140-255 | KPSNTLGRGTDGSSCGVLVCKFAQNIIEGKPLEVPNIMAARKEIVTMLLDYTDLTMLDEYCTYCCCMEDDGEGVIEWVDCVVCGRWF… |
| A0A7M5XDD8 | 18-132 | None |
| A0A7M5UJC7 | 4-119 | None |
| A0A2I4CQC5 | 5-118 | None |
| A0A6P8VKT6 | 1-115 | None |
| A0A498NWP6 | 9-105 | None |
| T1F7C3 | 589-687 | None |
| A0A6P8TMA8 | 177-299 | None |
| A0A1B0AGH2 | 206-335 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.