DPCstruct | MC277
Metacluster Properties and Pfam Annotations
| Number of structural domains | 20 |
|---|---|
| Mean domain length (aa) | 74 ± 9 aa |
| Standard deviation of domain lengths | 8.64 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 82.65 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.70 |
| Mean intra-cluster local Distance Difference Test score | 0.82 |
| Mean intra-cluster sequence similarity (%) | 30.31 |
| Pfam Score | 93.75 |
| Assigned Pfam label(s) | PF21757- CL0123 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A396QR17 | 9-71 | LDSLVDIRDVEIDKTLPIEERMKSYVEQIKNPYMFKVGETIVRVSYANTQETLNDNFVNLLAS |
| A0A645H9L3 | 7-82 | LEKMRLIDPLTVNQDELIDIQDVEINNELPKEDRISDYISQIKNPYLCKCGNLVIQSEFTETDITLNDRLKQLFRM |
| A0A498CJ15 | 6-74 | None |
| A0A173UND4 | 36-116 | None |
| A0A369MPT9 | 3-61 | None |
| A0A1F8V424 | 8-81 | None |
| A0A1Y4RFY9 | 2-67 | None |
| B0G1S2 | 1-95 | None |
| J0N054 | 214-299 | None |
| A0A6L5X6Q2 | 26-100 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.