DPCstruct | MC27699
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 134 ± 10 aa |
| Standard deviation of domain lengths | 10.29 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 87.62 |
| Mean fraction of residues predicted as intrinsically disordered | 0.30 |
| Mean length-normalized TM-Score | 0.88 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 29.86 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A399WV85 | 2-127 | MLIRATIVWLVILVFAVLNGILREAVLFPAVGRVPGFITSGIILGLIIFVVAYLTLPWIDAAGSNQLLLIGFLWLMLTLAFEFSFGL… |
| A0A5C7ZDB1 | 2-116 | LVVSVLNGIARDAGYGRELEPLVAHQLSTLYGMTLLGVVIGAYAWRWPFASAAAAWRAGCLWLALTVAFEFIFFRYVTGHSWSELLA… |
| A0A557QY44 | 10-149 | None |
| A0A2V8TVS2 | 1-137 | None |
| A0A849QDP1 | 10-131 | None |
| A0A1E4PL26 | 2-134 | None |
| A0A6I7LWI2 | 21-170 | None |
| A0A524E0C4 | 1-133 | None |
| A0A3A4K0Y3 | 1-151 | None |
| A0A290T0P2 | 3-135 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.