DPCstruct | MC27693
Metacluster Properties and Pfam Annotations
| Number of structural domains | 30 |
|---|---|
| Mean domain length (aa) | 182 ± 31 aa |
| Standard deviation of domain lengths | 30.56 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 86.87 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.65 |
| Mean intra-cluster local Distance Difference Test score | 0.61 |
| Mean intra-cluster sequence similarity (%) | 22.21 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF11013 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3M1BT51 | 39-253 | KIAEPDEALYRELMVSLGYPKNRVQFLNLALLLPFKEIRLLKTKDLIRKALLYRAGFEENVDELPPFFDLSLRMERFQWVEKGIRPA… |
| A0A7C5JLH0 | 43-203 | KFSKLRPLNFPTIRISQLAKILFVQNHLFRNVFECPDLKCLKEIFKISTTDYWKNHFVFDETSINKQKNLGKTAIEVLIINTIIPAL… |
| A0A1Y1RKR6 | 290-517 | None |
| A0A1V5NJZ5 | 25-201 | None |
| A0A3D3CTU8 | 7-133 | None |
| A0A136LEE1 | 228-434 | None |
| A0A7X8XDR1 | 2-145 | None |
| A0A3L7YHI9 | 58-231 | None |
| A0A832GV49 | 192-380 | None |
| A0A0S8FA53 | 5-192 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.