DPCstruct | MC2769
Metacluster Properties and Pfam Annotations
| Number of structural domains | 46 |
|---|---|
| Mean domain length (aa) | 136 ± 19 aa |
| Standard deviation of domain lengths | 19.23 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 84.95 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.54 |
| Mean intra-cluster local Distance Difference Test score | 0.62 |
| Mean intra-cluster sequence similarity (%) | 21.01 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5E4LAT0 | 191-316 | FGRSMNVIDCGDYQNAVNIYRGSFVFDSKNIAYSFFPKFCEDAYGCHMLLSCKYCMRCRNSTNLNRCFEVTDSNNCSDCYFCHNCEN… |
| A0A7X9DV98 | 11-133 | DRLRKEFSQEASNPGSFESKRCVQCSSCMFCEDCERCYRCTHAKACQECSHVTHSKNCRHCHHCAYCRECTNCSGSSYLELCENCID… |
| A0A7X5R5B4 | 65-206 | None |
| A0A1F6UUP6 | 103-262 | None |
| A0A1F6UQJ5 | 1-121 | None |
| A0A511THP4 | 28-161 | None |
| A0A1J5HIM1 | 4-144 | None |
| A0A1F6BWI6 | 1-101 | None |
| A0A6J4TJT4 | 27-111 | None |
| A0A554K3W3 | 4-145 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.