DPCstruct | MC27688
Metacluster Properties and Pfam Annotations
| Number of structural domains | 38 |
|---|---|
| Mean domain length (aa) | 117 ± 15 aa |
| Standard deviation of domain lengths | 14.94 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 88.20 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.82 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 32.77 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1F7LGN8 | 1-98 | MDVSEVEIESGIIAFIEEEAVPADAKVLRQTWKKANKDGSPDRRFANNYQIPVVEYGRLTVTSSGDLNEEYMLSSFAAVTQFTSLWK… |
| B3QWZ1 | 8-120 | NANGGDLFIYPAFLAIIDSSRKFGLIDIRELDFDFHAQRFLEEEKIPKDAVVVDHTWAKVNKNGTPDKRFKDNYQIPICQYGEVALT… |
| A0A543IWU8 | 404-506 | None |
| A0A2E2DKR4 | 177-287 | None |
| A0A1M6RZF3 | 221-340 | None |
| A0A7J9ZY29 | 307-418 | None |
| A0A4R2V280 | 99-231 | None |
| A0A810L5P2 | 136-276 | None |
| A0A511MHV2 | 1-74 | None |
| A0A5J4P8G2 | 9-115 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.