DPCstruct | MC27681
Metacluster Properties and Pfam Annotations
| Number of structural domains | 55 |
|---|---|
| Mean domain length (aa) | 156 ± 23 aa |
| Standard deviation of domain lengths | 22.59 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 82.52 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.79 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 32.33 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2N5ZR26 | 71-200 | TKSPDYEFSDKLKGKIVLQVESNGEAWYIDPIDLKRYYFGSPRETYLFIREKSKYLSGEEIFDYLFFEKIFPKELSGRFIANQDEDN… |
| A0A1F5TNJ9 | 13-195 | TTFVLLFSCFLVFSPPKSLAADSLTARLRGRLLLQAQSRGQVWYVNPIDDRRYEVNAENALSIFRALALGITNDDLEKIPTDTNFIN… |
| A0A2N6A7P3 | 313-512 | None |
| A0A2N6A6X6 | 12-144 | None |
| A0A2N6A1G9 | 18-211 | None |
| A0A2N5ZTE3 | 406-583 | None |
| A0A2N5ZRR6 | 25-201 | None |
| K1Y773 | 12-161 | None |
| A0A0G1BBS1 | 1-149 | None |
| A0A1F5TRD1 | 2-179 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.