DPCstruct | MC2768
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 73 ± 5 aa |
| Standard deviation of domain lengths | 4.87 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 83.63 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.69 |
| Mean intra-cluster local Distance Difference Test score | 0.69 |
| Mean intra-cluster sequence similarity (%) | 34.24 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A662QLK7 | 27-105 | PSNCAQEGELFSNVFTDKYPEHCCEGLMDWHSGMDTSISIADTCYQTGLLSGWPVGTCLNCGNNICEDIETPCNCPEDC |
| A0A511TH24 | 128-201 | QPRYPNEATCAEEGILGANVACCPGLVPRCGSLEHYVGPKCDPIEGTTAEPVCVRCGDGVCGRAEQVCNCPEDC |
| A0A7C4SNC6 | 200-267 | None |
| A0A5E4JPN9 | 92-159 | None |
| A0A150QKH0 | 145-210 | None |
| A0A4Y6CQG3 | 44-114 | None |
| A0A256ZQ08 | 9-87 | None |
| A0A2H0WLF0 | 369-443 | None |
| A0A0B3AFB9 | 136-216 | None |
| A0A662FLG6 | 74-149 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.