DPCstruct | MC27679
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 76 ± 5 aa |
| Standard deviation of domain lengths | 4.79 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 83.29 |
| Mean fraction of residues predicted as intrinsically disordered | 0.15 |
| Mean length-normalized TM-Score | 0.85 |
| Mean intra-cluster local Distance Difference Test score | 0.83 |
| Mean intra-cluster sequence similarity (%) | 67.99 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A831YGX0 | 31-119 | DWVKKWLDLRERLIKIAKVLRRFPWMVEVIKQRPMGILHPYTVEVYVARDGSEACLSLNPPKAYCVQNGAVKEVKLDLEFSRYEVYE… |
| A0A0K1E3G4 | 1-77 | MEWVRKWLGLRERLVEIAKVLKRFPWMVDVVKQRPMSILHPYAVEVYVAKDGSEVCLSLNPPKAFCARDGAVKETRL |
| A0A832DT66 | 85-161 | None |
| A0A831YCH9 | 144-218 | None |
| A0A6B2CTV5 | 13-88 | None |
| A0A0K1E4E3 | 108-183 | None |
| A0A831YDN4 | 32-103 | None |
| A0A831V0H8 | 191-267 | None |
| A0A101XFJ1 | 1-77 | None |
| A0A101XDJ5 | 53-120 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.