DPCstruct | MC27678
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 78 ± 9 aa |
| Standard deviation of domain lengths | 9.36 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 86.72 |
| Mean fraction of residues predicted as intrinsically disordered | 0.46 |
| Mean length-normalized TM-Score | 0.88 |
| Mean intra-cluster local Distance Difference Test score | 0.84 |
| Mean intra-cluster sequence similarity (%) | 29.84 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0378 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6N9Y6R0 | 2-74 | VYVSASSRFRTPTRVAFDHEALRRGAAEPCDSGAPGAIQLIACGTSYGQHVVIADPETGVRLPDGRVGEIWVH |
| A0A7G1IP46 | 61-134 | FVSTTAPNEPPTVIHVDRDELNKQRFVEVPADSPNAVAQVSAGKVGVDEWAVIVDPDTASELPDGQIGEIWLHG |
| A0A3M6VRC2 | 96-189 | None |
| A0A7C7R2Y6 | 486-578 | None |
| A0A1D2PC34 | 5-81 | None |
| A0A437QHI5 | 329-402 | None |
| A0A450WQ71 | 224-289 | None |
| A0A450UTY7 | 1-89 | None |
| A0A1V4JC84 | 373-441 | None |
| T2IZM9 | 12-81 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.