DPCstruct | MC27670
Metacluster Properties and Pfam Annotations
| Number of structural domains | 20 |
|---|---|
| Mean domain length (aa) | 106 ± 12 aa |
| Standard deviation of domain lengths | 12.28 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 91.58 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.88 |
| Mean intra-cluster local Distance Difference Test score | 0.83 |
| Mean intra-cluster sequence similarity (%) | 29.85 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF01629 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A832WS95 | 23-123 | DFKTDMFEGRFEPLIAAEDVTVEEGEDVIIKVEPIEIPPHTMVLLSPYARNPYGHVLAVAEEFPKMMELGRKVEQVYFAAVRHGRIR… |
| A0A3L6J7N0 | 5-100 | WSNSKLMPVIASEKVAFAAGETKIIEIRPIRIPAYSMVVQSFFGVNGAVHLLCLGASQFKPFSEDRIAEIAQLQSRMKCSVLPWDLL… |
| A0A662VYT9 | 24-122 | None |
| A0A7C2N966 | 1-105 | None |
| A0A7C2SL91 | 24-114 | None |
| A0A7J4EKA9 | 46-156 | None |
| A0A7J3M064 | 5-91 | None |
| A0A7J3M0B6 | 45-138 | None |
| A0A662VW72 | 7-111 | None |
| A0A7C2SPX2 | 42-174 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.