DPCstruct | MC2767
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 126 ± 5 aa |
| Standard deviation of domain lengths | 5.07 |
| Length coefficient of variation | 0.04 |
| Mean AlphaFold2 pLDDT confidence score | 90.68 |
| Mean fraction of residues predicted as intrinsically disordered | 0.16 |
| Mean length-normalized TM-Score | 0.78 |
| Mean intra-cluster local Distance Difference Test score | 0.70 |
| Mean intra-cluster sequence similarity (%) | 35.08 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7X8IZ81 | 222-349 | KGVDPIAYCGFSCNHCFLSEWCGSCRTEYNVCSFATQYEDKRCPNAVCCMEKNIDGCYECSELEDCTKGFYTPDNDGAASAKAQAMF… |
| A0A7X7XUJ9 | 392-514 | ANSIAYCGLVCRLCHLAYKCDGCRSENNCCGSRKTDEGCYQYNCCTKKGLNGCWECDIAPCDKGMFSAGHDIRLRAFVNYIKEKGKD… |
| A0A1C5ZHZ0 | 1-122 | None |
| A0A174GGH0 | 102-223 | None |
| A0A1F8V144 | 2-121 | None |
| R0B1B4 | 1-130 | None |
| A0A7X7L705 | 10-135 | None |
| A0A1H8A242 | 20-154 | None |
| A0A1T4JZM1 | 178-303 | None |
| A0A3A9EJC6 | 102-222 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.