DPCstruct | MC27668
Metacluster Properties and Pfam Annotations
| Number of structural domains | 35 |
|---|---|
| Mean domain length (aa) | 117 ± 10 aa |
| Standard deviation of domain lengths | 9.67 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 75.40 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.70 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 35.05 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0229 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| Q09819 | 110-223 | RKATIRNVDYCSACGGRGLFICCEGCPCSFHLSCLEPPLTPENIPEGSWFCVTCSIKSHHPPKHPLSIWSQLYDWIDSQNPSQYRLP… |
| A0A1B5L706 | 1-114 | MPKDPAAENDEYCSACGNTGDVVCCDGCPRSFHFECVDMVQSDSLPDEWFCNECLIRRYPSRVPVHKGIFGSALNYLEKCIPRAFSL… |
| A0A421J8Z3 | 669-776 | None |
| A0A2U1IVM0 | 585-710 | None |
| A0A397UZ60 | 29-143 | None |
| A0A7D8Z7C1 | 134-254 | None |
| A0A165T9J0 | 203-315 | None |
| A0A1X2GIB6 | 73-192 | None |
| A0A1V6PEG9 | 637-734 | None |
| A0A0C9U6G2 | 237-337 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.