DPCstruct | MC27667
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 179 ± 14 aa |
| Standard deviation of domain lengths | 14.02 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 81.00 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.78 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 32.02 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3N4KVI7 | 449-600 | APMPGQVLNTTRQRVLDVSLLYERLFVIVLGTIYGRSDSETIAGFVGFAASLRAGVNIRVLREDDDVVARWVVSTMIKEGDEGKLLE… |
| A0A1B5L3T5 | 1-194 | MACNLVTGCFGANEDWMLFGLHTVGPVGSHALTTVRQRIYNLSLKYKTLIIFVAETASSKEDRISLSTSDMAAYTDFVCFTTSLRAI… |
| A0A6A5R0Z6 | 776-959 | None |
| A0A178B1P9 | 603-792 | None |
| A0A0M8N941 | 1-165 | None |
| A0A164ZNW1 | 297-483 | None |
| A0A166U8Q3 | 243-410 | None |
| A0A6A6XR34 | 740-942 | None |
| A0A4S8VBW1 | 316-490 | None |
| A0A428TF74 | 94-263 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.