DPCstruct | MC27666
Metacluster Properties and Pfam Annotations
| Number of structural domains | 98 |
|---|---|
| Mean domain length (aa) | 120 ± 21 aa |
| Standard deviation of domain lengths | 20.96 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 82.21 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.69 |
| Mean intra-cluster local Distance Difference Test score | 0.71 |
| Mean intra-cluster sequence similarity (%) | 30.26 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF09362 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2P4XR54 | 3-153 | RFDCFNNLVVDRVDPIVNPGEASGHLHAISGGNGFSKSADGAAMKTSTCTSCPIGADLSAYWVPQLYVKFKNGTGYGLVESHQIVYY… |
| A0A1B5L111 | 4-136 | PKLKILALLGLVSPEALAQLFTVNCAPLTTFRGDPIVFPGVLSSHVHAVVGGTRFALSLTNEEARNAKATTCDKVLDKSNYWQPLMY… |
| Q5AS43 | 349-485 | None |
| G3J8N5 | 131-243 | None |
| A0A2H4SEJ0 | 4-110 | None |
| A0A2D8F847 | 80-167 | None |
| Y0KIC6 | 301-427 | None |
| A0A2P4YMR6 | 3-153 | None |
| W9IYI1 | 1-94 | None |
| A0A1I1UND8 | 40-146 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.