DPCstruct | MC27663
Metacluster Properties and Pfam Annotations
| Number of structural domains | 23 |
|---|---|
| Mean domain length (aa) | 72 ± 8 aa |
| Standard deviation of domain lengths | 7.87 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 91.32 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.86 |
| Mean intra-cluster local Distance Difference Test score | 0.82 |
| Mean intra-cluster sequence similarity (%) | 36.92 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF10905 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3D0NYM2 | 10-92 | KAWKAEQKVLAKAAFPLPNDLLAEFFEFVEVSVGKEGCDRSRRFTEKWLVSKQIAQEPFTSWLETNGGFCDCEVAGNVFQHWE |
| A0A2V7QW22 | 6-79 | IPISHADLRDLFERLDRASMSGYQCRHTFAVTREFLSQRTLAVEPILEWLGENGAGCDCEVIFNTAPEWEEIVG |
| A0A2E0QW90 | 106-172 | None |
| A0A7W0M7A4 | 1-58 | None |
| A0A1G6UP40 | 70-139 | None |
| A0A7T9EH70 | 43-110 | None |
| A0A4P5YSF9 | 6-78 | None |
| A0A1A7KCN1 | 282-363 | None |
| D2MP04 | 10-79 | None |
| A0A6L7HYR6 | 1-70 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.