DPCstruct | MC27661
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 134 ± 9 aa |
| Standard deviation of domain lengths | 9.02 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 83.25 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.80 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 27.25 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1G8EML9 | 150-274 | SRNVAQSISILGFFEGKRVFFEALDVEHPGQVLESLIEIRSRINNALGQMKQEESASEALREINKKIRKFLTAHPRLNELKCDGSDP… |
| A0A0Q9K882 | 12-140 | WGLDWEYVASNKDLARRVLVFLEDRRVITDHPDREDFDSTRESADQIRKFLTLEIMNVKAGGELERALKAIRTASRAFVDAAGQDSK… |
| A0A5F2GVL6 | 19-172 | None |
| A0A7W6JXV0 | 104-238 | None |
| A0A6M7VSL1 | 3-142 | None |
| A0A5J6V319 | 17-155 | None |
| A0A7H9SGZ6 | 2-131 | None |
| A0A2S4XI80 | 1-127 | None |
| A0A2T5GH21 | 23-146 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.