DPCstruct | MC2766
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 302 ± 22 aa |
| Standard deviation of domain lengths | 21.53 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 72.71 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.49 |
| Mean intra-cluster local Distance Difference Test score | 0.58 |
| Mean intra-cluster sequence similarity (%) | 19.10 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF05128 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7X6Z266 | 8-309 | LKRWILLPLIGFLAFFLLIVVNQSIQLVNWGSSLHPWLGYFLIILVLVLFLGLIVYPIFSILKFKVMPEMPKNSSSPEYQVYIDTLH… |
| A0A269PLQ6 | 56-332 | YDNKPSSLLKKVFVLSFTTLVFTELGLTVYHSFNSSIILGSLYSLLIISTLGLISKKCIKEYSQLRKLKSNQLQRIDANRLLHSQQI… |
| A0A3D2CT23 | 61-368 | None |
| A0A8B0T972 | 6-317 | None |
| A0A2D7H2L5 | 4-272 | None |
| A0A848E999 | 1-289 | None |
| A0A845LQ39 | 2-300 | None |
| A0A1Y4D0Y9 | 1-299 | None |
| A0A259S2P7 | 35-321 | None |
| A0A7Y2CGG5 | 40-353 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.