DPCstruct | MC27659
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 123 ± 11 aa |
| Standard deviation of domain lengths | 10.82 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 76.74 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.84 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 63.34 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0A9QF81 | 1-108 | MPEAAFAGSWMKSAHKLWVKRLRRTSSLPELLQVLVDFVGAMDEDWLYKSSSSVSFSSYLDDIIVYFQTMPQTTSAVALWVVKLDAL… |
| A0A6A6K968 | 160-269 | SSQLQSLKAAVHAIEAMPDEALLGAWTKSAHRLWVKRLRRTSSLAELLQVVADFVAAINEDWLCQCDVAHDSNTSMEEIIASFPTMP… |
| A0A7N0UBZ7 | 979-1086 | None |
| A0A287KD52 | 512-629 | None |
| A0A287KD01 | 382-499 | None |
| A0A6J5WVC7 | 20-144 | None |
| A0A2P2MBV6 | 647-771 | None |
| A0A1U8K5E0 | 824-946 | None |
| A0A5J5AW94 | 1-137 | None |
| A0A6P6W181 | 277-412 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.