DPCstruct | MC27654
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 103 ± 9 aa |
| Standard deviation of domain lengths | 9.14 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 83.23 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.75 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 36.20 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0124 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3Q0JJT4 | 3-89 | QTSCSVHSGASGGALLNQSGDLIGLVVCNVMDSLDSVTVVYPRVNMAVPICAFYSTLVAYLRTKDPSVLNSLNVSNTEVRQIWNLQP |
| A0A0A9Q6I3 | 1-90 | MLQTTAAVHPGASGGVLVNSYGRMVGLVTSNAKHGGGSTIPHLNFSIPCKSLEMIFKYSVIGDSTILEKLDRPNEVLSSVWALAPSS… |
| H3CT99 | 317-423 | None |
| A0A7R9T783 | 34-145 | None |
| V4B9Y7 | 454-565 | None |
| A0A3L7ILU3 | 282-377 | None |
| A0A2R5FYG3 | 509-602 | None |
| A0A6P8ZD64 | 113-224 | None |
| A0A0Q3QSS1 | 281-390 | None |
| A0A1S4EM54 | 171-280 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.