DPCstruct | MC27650
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 155 ± 18 aa |
| Standard deviation of domain lengths | 18.17 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 82.87 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.72 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 31.55 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF04121 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A821FBI1 | 1-156 | MAKAVQGWLQTIKLDERYQTDLKMAMTKLEPKRIYWEKTCHFLKSSYNANIPNPYITCLDFDAAHKQKRRLCDTDEQEENDLLQIVF… |
| A0A1R1YK72 | 324-472 | GYWPFTRKEYESCLRKKNLRPDLITQLDPDAPTRQQKRLAPEDLEYERFMLKSLYEFVRRGRLNDATMLCVNNGEPWRAASLRGGSF… |
| H2YVY0 | 206-352 | None |
| A0A1S3QVT0 | 4-161 | None |
| A0A5B7EIU2 | 121-307 | None |
| A0A183N6V8 | 1-172 | None |
| A0A7J7HK78 | 184-316 | None |
| A0A1X7VEL1 | 252-421 | None |
| A0A0W4ZF47 | 139-264 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.