DPCstruct | MC2765
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 176 ± 22 aa |
| Standard deviation of domain lengths | 21.67 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 79.52 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.82 |
| Mean intra-cluster local Distance Difference Test score | 0.71 |
| Mean intra-cluster sequence similarity (%) | 28.98 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF18948 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4U1BMX0 | 224-366 | NGFAGIFCVLAVTRWAGIDPDDSPERDVLWPGMTLIFILVYDVWNITFVYNSFPDLTSIQIAVLSAATLPAIFIKKGTWMQARIFTL… |
| A0A7X6XZX4 | 1-197 | IEAVFRDFQCYNIHGIENGLTMIGGPWNIINGVAGIINIITITGWLGIFISKKKSKDMIWPDLQWFWIIAYGLWNFSYIYNCISDRS… |
| A0A6V6YJ83 | 158-329 | None |
| A0A2N1QIR0 | 106-275 | None |
| A0A549YXH8 | 191-372 | None |
| C7N204 | 126-342 | None |
| A0A845Q3S8 | 39-236 | None |
| A0A5C2HN89 | 23-171 | None |
| A0A1V9I4R1 | 1-172 | None |
| A0A6H2EKF3 | 2-164 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.