DPCstruct | MC27648
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 123 ± 13 aa |
| Standard deviation of domain lengths | 13.15 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 79.52 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.60 |
| Mean intra-cluster local Distance Difference Test score | 0.64 |
| Mean intra-cluster sequence similarity (%) | 35.05 |
| Pfam Score | 90.28 |
| Assigned Pfam label(s) | PF14875- CL0016 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A553PT81 | 264-413 | VEELDALFDEPAFICDVKLEHFGMSNSQRMKLLDVDGLHLKPLAEQIVGGEVKCSTHSECNYFDCRGRCDLIEGKCVNEITNNNVQM… |
| A0A821F091 | 19-134 | MAYFDRLIPLNPAAKCRKHSDCSFFDCSGYCDKRKHRCHVNRRINNNLQVLCEKILLNLLKSNAIPLRLHDVLLSYVKQCSSPLGRY… |
| A0A091E228 | 236-370 | None |
| A0A8B6H9N5 | 1-119 | None |
| A0A812B0N6 | 262-366 | None |
| A0A813MZB3 | 370-471 | None |
| A0A7R8GZW2 | 464-573 | None |
| A0A151NF01 | 135-262 | None |
| A0A5F4CS72 | 1-120 | None |
| A0A6P3INJ2 | 133-258 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.