DPCstruct | MC27647
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 223 ± 39 aa |
| Standard deviation of domain lengths | 38.79 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 75.00 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.43 |
| Mean intra-cluster local Distance Difference Test score | 0.60 |
| Mean intra-cluster sequence similarity (%) | 26.25 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0550 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A016X160 | 17-169 | GALAQGQVVIDPGLIPVRQPIQNILGGVYSNNVTLFFRNSPYRVTSDLTVEYGATLTIETGVQIYFDTGVGLKIKGTLQAIGNEFAH… |
| A0A821F0J2 | 1-203 | MYLVIILSLFCYCQSTKLPNLVGNILLTRLESPYDASGDTIIPYDSTVTIESGTILRFPRGAQLIVRGRFLAKGTPDRRIVFTSSTS… |
| A0A814KI36 | 2-187 | None |
| A0A183QT42 | 30-229 | None |
| A0A1S3IG14 | 3-222 | None |
| A0A6P8HYJ0 | 3-219 | None |
| A0A2A6CGQ7 | 1-276 | None |
| A0A3M7SQX3 | 4-208 | None |
| A0A158Q5A1 | 1-241 | None |
| A0A6A0GUL9 | 403-682 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.