DPCstruct | MC27646
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 91 ± 10 aa |
| Standard deviation of domain lengths | 10.39 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 86.22 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.84 |
| Mean intra-cluster local Distance Difference Test score | 0.85 |
| Mean intra-cluster sequence similarity (%) | 33.20 |
| Pfam Score | 95.00 |
| Assigned Pfam label(s) | CL0616- PF03730 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| D3BLK0 | 22-106 | MSEIKQALLSRYVKRNGRSASISLLYPHIKANYECIYVCQLPFLDDLKQYQFSPIVPTNAATRKPFIPTAEQVDAARALIDSMDL |
| A0A821EP67 | 1-81 | MYDASTVAIVRKCFSERSSSELCFLRPHIAHDHICMYYVKLSFAEDLREFDFDNLDAIKRNQLNDEQLKTIDNLITTMNLT |
| A0A673HHB1 | 87-189 | None |
| A0A7R9E6I2 | 1-79 | None |
| A0A6V7QYY2 | 1-87 | None |
| A0A7N0T050 | 27-114 | None |
| A0A183NIA4 | 69-171 | None |
| A0A2G3B839 | 1-89 | None |
| A0A445E6E5 | 324-433 | None |
| A0A8B6DPW3 | 1-76 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.