DPCstruct | MC27645
Metacluster Properties and Pfam Annotations
| Number of structural domains | 21 |
|---|---|
| Mean domain length (aa) | 100 ± 10 aa |
| Standard deviation of domain lengths | 9.56 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 77.85 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.73 |
| Mean intra-cluster local Distance Difference Test score | 0.84 |
| Mean intra-cluster sequence similarity (%) | 45.83 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF13625 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A821EHX4 | 1-94 | MYAAISIGLQTNDIIETLQQLSSTIISNMIIEFTKLCALNYGKVKLVLKHNQYFVESVFSRYLKNLLHDSQIQECRLITRKINIDIN… |
| A0A815PSD0 | 60-143 | HSAMFSGLQTQDMIEDLQQLSKTNISDDLINYIKSCTEMYGKVKLVLKHKRYFIESIFPNILNELLQDSEIKECQAISTEQDLN |
| A0A6A5DES2 | 187-295 | None |
| A0A086LCV2 | 185-279 | None |
| A0A177WNC2 | 130-230 | None |
| A0A821HLA5 | 21-116 | None |
| A0A3P7M494 | 58-168 | None |
| A0A814NIL5 | 110-225 | None |
| A0A507C393 | 267-361 | None |
| A0A812RKQ7 | 84-195 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.