DPCstruct | MC27640
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 60 ± 2 aa |
| Standard deviation of domain lengths | 2.45 |
| Length coefficient of variation | 0.04 |
| Mean AlphaFold2 pLDDT confidence score | 88.36 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.93 |
| Mean intra-cluster local Distance Difference Test score | 0.95 |
| Mean intra-cluster sequence similarity (%) | 54.89 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0280 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A821DEP7 | 1-62 | QQKSEHFDSNCITPGTPFMSKLADYLRYYIRHRMNTNPAWRSIEVILSDANVPGEGEHKIMD |
| A0A7S4B9C7 | 20-75 | PFDSNCITPGTEFMSRVSTHLRYFIRYKLQHDELWRGLRVVLSDGSVPGEGEHKIM |
| A0A183M274 | 16-75 | None |
| A0A815BZ69 | 13-76 | None |
| E2LJZ2 | 62-120 | None |
| U6KCD0 | 54-113 | None |
| A0A817JCV7 | 28-82 | None |
| A0A0C2TBH4 | 40-100 | None |
| A0A843XLZ7 | 66-126 | None |
| A0A7J9CTU1 | 39-99 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.