DPCstruct | MC2764
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 168 ± 9 aa |
| Standard deviation of domain lengths | 8.69 |
| Length coefficient of variation | 0.05 |
| Mean AlphaFold2 pLDDT confidence score | 85.24 |
| Mean fraction of residues predicted as intrinsically disordered | 0.29 |
| Mean length-normalized TM-Score | 0.70 |
| Mean intra-cluster local Distance Difference Test score | 0.67 |
| Mean intra-cluster sequence similarity (%) | 31.71 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| I4YK73 | 1-173 | MELGGTRSFGGRVIVGTQTLEQSLDIDADFLITDLCPVDVLLQRLGRLHRNGRNKRPHGFSILQAVIVVPSRRDLTPLVKAPRNGLG… |
| A0A6N7ZT48 | 323-494 | ERAFGKNSKRDAVVAVGTQTIEQSLDIDADILITDICPMDVLLQRLGRLHRHTQRMRPEGFEIPTAIALVPDHDLSDFTKKADHGIG… |
| A0A2K8U8V6 | 93-256 | None |
| A0A7Y5Q2H7 | 22-196 | None |
| A0A109BPX3 | 72-246 | None |
| A0A7R8WSJ3 | 465-617 | None |
| A0A5A7NL05 | 295-468 | None |
| A0A401FWW9 | 611-762 | None |
| A0A378DJ96 | 105-275 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.