DPCstruct | MC27639
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 385 ± 46 aa |
| Standard deviation of domain lengths | 45.93 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 79.71 |
| Mean fraction of residues predicted as intrinsically disordered | 0.29 |
| Mean length-normalized TM-Score | 0.79 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 39.72 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2R8ZGQ5 | 2-411 | WVLLFCLVMASCQYSLLKSVQPDPASPIHGHNQIITYSRPIYFCVLCGLILLLDTGAKARHPPSYVVYGLKLFSPVFLQSARDYLIV… |
| A0A821DE97 | 1-320 | GFNRNTAISRAIYFCLFSSLLLIIYKLKTFSWHFILFGITFSNIIVCYMIYNILSIILLCLPILFLFGLLPQCSTFFLCILENFDMH… |
| E9PSU6 | 1035-1447 | None |
| A0A5S6PFV0 | 845-1183 | None |
| A0A0R3QU75 | 45-459 | None |
| A0A368FWK9 | 378-735 | None |
| A0A817H6Q9 | 710-1029 | None |
| A0A482XFZ4 | 307-682 | None |
| A0A1Y1JUQ8 | 163-523 | None |
| A0A6L2PPS9 | 601-973 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.