DPCstruct | MC27637
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 88 ± 11 aa |
| Standard deviation of domain lengths | 10.72 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 83.22 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.80 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 37.88 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A821CZX1 | 1-94 | MFETTESWHDNYLCTNRDIDLHWIWDNRVCRADLKCVATAEPGDNRWNDNALCVPAQSKIELVWSYCGKVAHMSCIQLFDPAAPGYT… |
| A0A6N6T6N9 | 130-209 | QKKCQGLPSFAWSQAGPISGQVCIRIYEDADPHAWSDNYLCSSRDLGLNWSQAGPIAGMSCTRIYEDADPHAWGDNYLCV |
| A0A0J9E5R2 | 78-162 | None |
| A0A7Y6X759 | 376-452 | None |
| A0A2E9R7V2 | 200-285 | None |
| A0A813YL91 | 55-131 | None |
| A0A150PPT4 | 73-178 | None |
| A0A818QMB8 | 40-112 | None |
| A0A833M3B8 | 3-108 | None |
| A0A0K1EA09 | 346-432 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.