DPCstruct | MC27635
Metacluster Properties and Pfam Annotations
| Number of structural domains | 20 |
|---|---|
| Mean domain length (aa) | 153 ± 28 aa |
| Standard deviation of domain lengths | 27.91 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 80.83 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.80 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 52.74 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF16507 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3P7J247 | 1-140 | MVFVAVKMHPSLSFVRFFSLIKKKLQQTITTETYLEEKVDFQVIWWLSMADRVLKAPSSYLLENWAEVRSLLEIVLPLKKCTLATEK… |
| A0A821BS83 | 149-274 | VRAIVNANPREILKHLLPQTCEHIENIINNSRMTILTDYRGNIEFTWHLILFSELLRVRGDALLTYKQMIMSVFHRCIRVVHKDSYE… |
| A0A817GK91 | 1-181 | None |
| A0A817GV50 | 2-145 | None |
| A0A819N5H1 | 2-146 | None |
| A0A820EMG7 | 1-193 | None |
| A0A821FZJ2 | 2-144 | None |
| A0A820U4T1 | 2-145 | None |
| A0A819ZZ82 | 73-220 | None |
| A0A821K125 | 4-203 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.