DPCstruct | MC27634
Metacluster Properties and Pfam Annotations
| Number of structural domains | 19 |
|---|---|
| Mean domain length (aa) | 95 ± 6 aa |
| Standard deviation of domain lengths | 6.15 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 85.31 |
| Mean fraction of residues predicted as intrinsically disordered | 0.15 |
| Mean length-normalized TM-Score | 0.93 |
| Mean intra-cluster local Distance Difference Test score | 0.89 |
| Mean intra-cluster sequence similarity (%) | 48.25 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF01992 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A060SAQ5 | 6-84 | FNVDSGFLEGIVRGYKAGLLTQNQYNNLTQCETIEDFRTQLSATDYGNFLANEPLPISTSTISDRATQVLVDQFNFLRS |
| A0A2T6IGR3 | 1-98 | MELSFFNVDDGYLEGICRGLRSAFLTEEDYKKLSAADSLEDLRSALEETDYGPFMQDEPLPLAVPTLSQKCREKMASEFRYMRSQAS… |
| A0A4V3WIS0 | 5-100 | None |
| A0A816NJT0 | 321-417 | None |
| A0A448WY66 | 7-98 | None |
| X6MRW7 | 29-124 | None |
| A0A0W8CMG1 | 9-103 | None |
| A0A448ZPP0 | 1-97 | None |
| A0A820ZI45 | 3-117 | None |
| A0A2Y9P9V5 | 5-100 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.