DPCstruct | MC27633
Metacluster Properties and Pfam Annotations
| Number of structural domains | 22 |
|---|---|
| Mean domain length (aa) | 100 ± 9 aa |
| Standard deviation of domain lengths | 9.07 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 91.61 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.83 |
| Mean intra-cluster local Distance Difference Test score | 0.88 |
| Mean intra-cluster sequence similarity (%) | 39.57 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0264 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7Y3CB34 | 6-104 | KKVHYFPSYELMMDELRDYRFYESDMVHPNALAVDYIWEKFSSMCVDSKEHAVMLSVEEIRKGLAHIPFNPHSEAHKAFKLALGEKI… |
| A0A496KEM6 | 109-204 | TWQFYFPAYEILLDELRDYRFFASDMLHPSEQAVDYIWEKFRETVFSSDLNDCASHLYSIRQALAHRPLHPESDDYRKFYTKTQQRI… |
| A0A0G4H3N2 | 445-536 | None |
| A0A4Q3RJ22 | 143-259 | None |
| A0A060RCP1 | 205-295 | None |
| A0A7X6XFU1 | 1-83 | None |
| A0A5N7YYW1 | 16-117 | None |
| A0A090VCG0 | 58-154 | None |
| A0A7W4DXM5 | 392-496 | None |
| B5JHD6 | 135-224 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.