DPCstruct | MC27629
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 110 ± 12 aa |
| Standard deviation of domain lengths | 12.06 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 79.93 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.71 |
| Mean intra-cluster local Distance Difference Test score | 0.85 |
| Mean intra-cluster sequence similarity (%) | 58.53 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0010 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A453MQQ3 | 117-224 | DMSYTVPYSTFENITNDINEISGISSDADSEVDTSVATATLLDLYSGCGGMSTGLCLGAALAGLKLETRWAVDFNSHACKSLKSNHP… |
| A0A287V459 | 146-253 | DMSYSVAYSTFANIPSDTTENSGISTDADSENGTPVKTASLLDLYSGCGGMSTGLCLGSALAGLKLETKWAVDLNSFACKSLKYNHP… |
| A0A6J5UR07 | 38-137 | None |
| A0A5J5BBV5 | 41-168 | None |
| A0A453MQQ4 | 1-86 | None |
| A0A453MQP6 | 2-100 | None |
| A0A453IKS4 | 1-123 | None |
| A0A453TB98 | 57-183 | None |
| A0A3Q7HJM1 | 455-572 | None |
| A0A438IY51 | 42-142 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.