DPCstruct | MC27627
Metacluster Properties and Pfam Annotations
| Number of structural domains | 39 |
|---|---|
| Mean domain length (aa) | 236 ± 49 aa |
| Standard deviation of domain lengths | 49.18 |
| Length coefficient of variation | 0.21 |
| Mean AlphaFold2 pLDDT confidence score | 71.29 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.54 |
| Mean intra-cluster local Distance Difference Test score | 0.62 |
| Mean intra-cluster sequence similarity (%) | 28.63 |
| Pfam Score | 98.44 |
| Assigned Pfam label(s) | PF05910- PF01699 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A498K8K3 | 167-458 | TYLTLTWSKTLFSHSLTIHASNSFSLTISLNPSTFSFFRTRPGSKSISLTHSHHKRIKLYWDFTRADFTHNSAEPESCFYIAISCNA… |
| A0A7N0VMI7 | 33-277 | HNVTFAWVKSWTTHSLTMTVQSTRNEDEYECEILLQSYLFKCNKGRKTFQVGCQDVSLFWDLRSAKHSNGPQPCSSYYIALASNGEI… |
| A0A835N2T5 | 26-305 | None |
| A0A5D2YH07 | 1-208 | None |
| A0A6A2X7L4 | 36-289 | None |
| A0A3L6QSI6 | 10-191 | None |
| A0A3L6S2F1 | 171-434 | None |
| A0A6A6N8L5 | 24-297 | None |
| A0A6A1UYE5 | 11-232 | None |
| A0A6G1DF55 | 239-479 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.