DPCstruct | MC27625
Metacluster Properties and Pfam Annotations
| Number of structural domains | 57 |
|---|---|
| Mean domain length (aa) | 269 ± 61 aa |
| Standard deviation of domain lengths | 60.70 |
| Length coefficient of variation | 0.23 |
| Mean AlphaFold2 pLDDT confidence score | 77.74 |
| Mean fraction of residues predicted as intrinsically disordered | 0.36 |
| Mean length-normalized TM-Score | 0.67 |
| Mean intra-cluster local Distance Difference Test score | 0.69 |
| Mean intra-cluster sequence similarity (%) | 37.40 |
| Pfam Score | 87.65 |
| Assigned Pfam label(s) | PF00305- CL0321 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A660KMY4 | 1-285 | MEQSYLPSQTPSGLRRLREEDLENLRGNGEGERKSFERIYNYDVYNDLGDPDKSLKLQRPVLGGKEHPYPRRCRTGRPHCDSDPRSE… |
| A0A498JW59 | 162-429 | VDPKFGKPGAITVSNGYENEFYLESVNIEGVVDFPCNSWVQPQRVMSVQRIFFCSKAYLPGETPEGLKELREMELRQLRGDGKGLRT… |
| A0A1R3IW64 | 62-405 | None |
| A0A078HY96 | 162-392 | None |
| A0A7N0VBI8 | 3-228 | None |
| A0A836DLR1 | 6-264 | None |
| A0A7I4DG97 | 38-247 | None |
| A0A843X570 | 144-422 | None |
| A0A6J5WA09 | 74-376 | None |
| A0A835HMS8 | 140-447 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.