DPCstruct | MC27620
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 79 ± 6 aa |
| Standard deviation of domain lengths | 5.95 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 84.95 |
| Mean fraction of residues predicted as intrinsically disordered | 0.29 |
| Mean length-normalized TM-Score | 0.89 |
| Mean intra-cluster local Distance Difference Test score | 0.89 |
| Mean intra-cluster sequence similarity (%) | 52.53 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0020 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| M1B3M8 | 1-86 | MGEGLAHLERIATLKEPDDPKSKAHYYDGLVLLSSILINVGRKKDAINYLQMATAYDESYREFLQQCENEEDVISNDLVTSRRRDY |
| A0A6N2L3Z9 | 76-144 | GKNAEGIMHLERITSLEEPEDPNSKAHYFDGLLLLASALSKEDRNAEAVKYLRLVVAYDPSRKEFLDQC |
| A0A2Z6PL00 | 317-390 | None |
| A0A835LGA1 | 1-76 | None |
| A0A067KES6 | 68-155 | None |
| A0A803PYY0 | 972-1055 | None |
| A0A5B6YGX5 | 257-331 | None |
| A0A3Q7ITF5 | 94-167 | None |
| W1PFC7 | 456-535 | None |
| A0A453QUQ1 | 131-216 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.