DPCstruct | MC2762
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 58 ± 3 aa |
| Standard deviation of domain lengths | 2.68 |
| Length coefficient of variation | 0.05 |
| Mean AlphaFold2 pLDDT confidence score | 85.75 |
| Mean fraction of residues predicted as intrinsically disordered | 0.15 |
| Mean length-normalized TM-Score | 0.88 |
| Mean intra-cluster local Distance Difference Test score | 0.87 |
| Mean intra-cluster sequence similarity (%) | 47.40 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0A9RY53 | 111-172 | MLNELSSTVVFERPKDEEFVRRWQLACEGNIAHVVVMPSVSIDKLDYFLNELVEKRATWYQD |
| A0A6J4VX75 | 1-60 | MLNKNSNTVVFQKPSDKLIKKWQLAAQGDLAHIVVMPNISQVKIDQFIDDLLHESLLACK |
| W4V4T7 | 1-57 | None |
| A0A2J8A1C2 | 513-571 | None |
| A0A1M4Z407 | 2-56 | None |
| A0A1V5NMJ1 | 42-94 | None |
| A0A6V2CQW0 | 20-76 | None |
| A0A6A2YS49 | 108-164 | None |
| A0A314L451 | 38-96 | None |
| A0A2G2YXD7 | 1-62 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.