DPCstruct | MC27619
Metacluster Properties and Pfam Annotations
| Number of structural domains | 18 |
|---|---|
| Mean domain length (aa) | 82 ± 9 aa |
| Standard deviation of domain lengths | 8.70 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 83.02 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.80 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 39.77 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3L6SJK1 | 130-210 | LTQALRYFKDSTDQHLLVQVWAPVKNGDRYVLTTSGQPFVLDHQSIGLLQYRAVSMMYMFSVDGENDGELGLPGRVYKLKV |
| M1B290 | 8-100 | RIQSVMEKMWTPNICLVQFWAPIKVNGSIFLSTADQPFAFYNEIDKRLSSYRKLCLDTLIPIDNKFYSYSYREIPFGPPGRVFSRRL… |
| A0A068VKN9 | 39-119 | None |
| A0A453N802 | 65-144 | None |
| A0A6L2JQT5 | 8-81 | None |
| A0A4S4E127 | 79-187 | None |
| A0A1D6EI97 | 4-93 | None |
| A0A445BV14 | 168-244 | None |
| A0A4S4ETP3 | 9-91 | None |
| A0A166DK63 | 2-81 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.